SCOPe 2.05: Domain d4g2xa_: 4g2x A:

Lineage for d4g2xa_ (4g2x A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
   contains mixed beta-sheet

4. Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families)

5. Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)

6. Protein automated matches [190420] (8 species)
   not a true protein

7. Species Momordica balsamina [TaxId:3672] [189375] (66 PDB entries)

8. Domain d4g2xa_: 4g2x A: [221673]
   automated match to d3mrwa_
   complexed with ctn, gol, nag

Details for d4g2xa_

PDB Entry: 4g2x, 1.78 Å

PDB Description: crystal structure of cytidine bound ribosome inactivating protein from momordica balsamina at 1.78 angstrom resolution

PDB Compounds: (A:) rRNA N-glycosidase

SCOPe Domain Sequences for d4g2xa_:

Sequence; same for both SEQRES and ATOM records:

>d4g2xa_ d.165.1.1 (A:) automated matches {Momordica balsamina [TaxId: 3672]}
dvsfrlsgadpssygmfikdlrnalphtekvyniplllpsvsgagryllmhlfnydgnti
tvavdvtnvyimgylalttsyffnepaadlasqyvfrsarrkitlpysgnyerlqiaagk
prekipiglpaldtaistllhydstaaagallvliqttaeaarfkyieqqiqerayrdev
pssatislenswsglskqiqlaqgnngvfrtptvlvdskgnrvqitnvtsnvvtsniqll
lntkni

Timeline for d4g2xa_:

• d4g2xa_ first appeared in SCOPe 2.03
  
• d4g2xa_ appears in SCOPe 2.04
  
• d4g2xa_ does not appear in SCOPe 2.06