![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
![]() | Protein Calmodulin [47516] (13 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [158477] (19 PDB entries) |
![]() | Domain d4g27r_: 4g27 R: [221666] Other proteins in same PDB: d4g27b1, d4g27b2, d4g27b3 automated match to d1wrza_ complexed with ca, gol, phu, so4 |
PDB Entry: 4g27 (more details), 1.65 Å
SCOPe Domain Sequences for d4g27r_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4g27r_ a.39.1.5 (R:) Calmodulin {Norway rat (Rattus norvegicus) [TaxId: 10116]} dqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgng tidfpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeev demireadidgdgqvnyeefvqmmta
Timeline for d4g27r_: