Lineage for d4g1kc_ (4g1k C:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1565957Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 1566289Family c.1.1.0: automated matches [191424] (1 protein)
    not a true family
  6. 1566290Protein automated matches [190605] (13 species)
    not a true protein
  7. 1566299Species Burkholderia thailandensis [TaxId:271848] [226422] (1 PDB entry)
  8. 1566302Domain d4g1kc_: 4g1k C: [221660]
    automated match to d1tmha_
    complexed with act, edo, na

Details for d4g1kc_

PDB Entry: 4g1k (more details), 2.35 Å

PDB Description: Crystal structure of triosephosphate isomerase from Burkholderia thailandensis
PDB Compounds: (C:) triosephosphate isomerase

SCOPe Domain Sequences for d4g1kc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g1kc_ c.1.1.0 (C:) automated matches {Burkholderia thailandensis [TaxId: 271848]}
qrikrvignwkmhgrlsgnqalltevaqgaqavhdnvaigvcvpfpylaqaqaqlqggrv
swgsqdvsaheqgaytgevaagmvaefgaayaivghserrayhgesnetvaakarralaa
gltpivcvgetlaereagtteqvvgaqldavlavlspdeaarivvayepvwaigtgksat
aeqaqqvhaflrgrlaakgaghvsllyggsvkadnaaelfgqpdidggliggaslksgdf
laicraak

SCOPe Domain Coordinates for d4g1kc_:

Click to download the PDB-style file with coordinates for d4g1kc_.
(The format of our PDB-style files is described here.)

Timeline for d4g1kc_: