SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4g1fc2 (4g1f C:509-766)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2136079Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2136080Protein automated matches [190543] (82 species)
    not a true protein
  7. 2136259Species Human (Homo sapiens) [TaxId:9606] [188340] (67 PDB entries)
  8. 2136342Domain d4g1fc2: 4g1f C:509-766 [221655]
    Other proteins in same PDB: d4g1fa1, d4g1fb1, d4g1fb3, d4g1fc1, d4g1fd1
    automated match to d1orva2
    complexed with 0wg, nag

Details for d4g1fc2

PDB Entry: 4g1f (more details), 2.9 Å

PDB Description: Crystal Structure of human Dipeptidyl Peptidase IV in complex with a pyridopyrimidinedione analogue
PDB Compounds: (C:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d4g1fc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g1fc2 c.69.1.0 (C:509-766) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah
qhiythmshfikqcfslp

SCOPe Domain Coordinates for d4g1fc2:

Click to download the PDB-style file with coordinates for d4g1fc2.
(The format of our PDB-style files is described here.)

Timeline for d4g1fc2: