SCOPe 2.03: Domain d4g04b3: 4g04 B:389-582

Lineage for d4g04b3 (4g04 B:389-582)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.126: Serum albumin-like [48551] (1 superfamily)
   multihelical; one domain consists of two similar disulfide-linked subdomains

4. Superfamily a.126.1: Serum albumin-like [48552] (1 family)

5. Family a.126.1.1: Serum albumin-like [48553] (2 proteins)

6. Protein Serum albumin [48554] (1 species)
   duplication: consists of three domains of this fold

7. Species Human (Homo sapiens) [TaxId:9606] [48555] (74 PDB entries)
   Uniprot P02768 29-596

8. Domain d4g04b3: 4g04 B:389-582 [221647]
   automated match to d1n5ua3

Details for d4g04b3

PDB Entry: 4g04, 2.3 Å

PDB Description: High-resolution Crystal Structural Variance Analysis between Recombinant and Wild-type Human Serum Albumin

PDB Compounds: (B:) serum albumin

SCOPe Domain Sequences for d4g04b3:

Sequence; same for both SEQRES and ATOM records:

>d4g04b3 a.126.1.1 (B:389-582) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
kqncelfeqlgeykfqnallvrytkkvpqvstptlvevsrnlgkvgskcckhpeakrmpc
aedylsvvlnqlcvlhektpvsdrvtkccteslvnrrpcfsalevdetyvpkefnaetft
fhadictlsekerqikkqtalvelvkhkpkatkeqlkavmddfaafvekcckaddketcf
aeegkklvaasqaa

Timeline for d4g04b3:

• d4g04b3 is new in SCOPe 2.03-stable
  
• d4g04b3 appears in SCOPe 2.04
  
• d4g04b3 appears in the current release, SCOPe 2.08