![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (2 families) ![]() automatically mapped to Pfam PF01948 |
![]() | Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein) |
![]() | Protein Aspartate carbamoyltransferase [54895] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [54896] (62 PDB entries) Uniprot P00478 |
![]() | Domain d4fyyb1: 4fyy B:7-100 [221623] Other proteins in same PDB: d4fyya1, d4fyya2, d4fyyb2, d4fyyc1, d4fyyc2, d4fyyd2 automated match to d1d09b1 complexed with ctp, mg, utp, zn |
PDB Entry: 4fyy (more details), 1.94 Å
SCOPe Domain Sequences for d4fyyb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fyyb1 d.58.2.1 (B:7-100) Aspartate carbamoyltransferase {Escherichia coli [TaxId: 562]} lqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlikientfl sedqvdqlalyapqatvnridnyevvgksrpslp
Timeline for d4fyyb1: