Lineage for d4fyxd2 (4fyx D:101-153)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3036286Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 3036845Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (2 families) (S)
    automatically mapped to Pfam PF02748
  5. 3036846Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein)
  6. 3036847Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (3 species)
  7. 3036848Species Escherichia coli [TaxId:562] [57828] (62 PDB entries)
    Uniprot P00478
  8. 3036891Domain d4fyxd2: 4fyx D:101-153 [221620]
    Other proteins in same PDB: d4fyxa1, d4fyxa2, d4fyxb1, d4fyxc1, d4fyxc2, d4fyxd1
    automated match to d1d09b2
    complexed with dcp, mg, utp, zn

Details for d4fyxd2

PDB Entry: 4fyx (more details), 2.09 Å

PDB Description: e. coli aspartate transcarbamoylase complexed with dctp, utp, and mg2+
PDB Compounds: (D:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d4fyxd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fyxd2 g.41.7.1 (D:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli [TaxId: 562]}
eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan

SCOPe Domain Coordinates for d4fyxd2:

Click to download the PDB-style file with coordinates for d4fyxd2.
(The format of our PDB-style files is described here.)

Timeline for d4fyxd2: