Lineage for d1bhgb1 (1bhg B:226-328)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 657603Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) (S)
  5. 657604Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (2 proteins)
  6. 657884Protein beta-Glucuronidase [49307] (1 species)
  7. 657885Species Human (Homo sapiens) [TaxId:9606] [49308] (1 PDB entry)
  8. 657887Domain d1bhgb1: 1bhg B:226-328 [22162]
    Other proteins in same PDB: d1bhga2, d1bhga3, d1bhgb2, d1bhgb3
    complexed with man, nag

Details for d1bhgb1

PDB Entry: 1bhg (more details), 2.6 Å

PDB Description: human beta-glucuronidase at 2.6 a resolution
PDB Compounds: (B:) beta-glucuronidase

SCOP Domain Sequences for d1bhgb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bhgb1 b.1.4.1 (B:226-328) beta-Glucuronidase {Human (Homo sapiens) [TaxId: 9606]}
tyidditvttsveqdsglvnyqisvkgsnlfklevrlldaenkvvangtgtqgqlkvpgv
slwwpylmherpaylyslevqltaqtslgpvsdfytlpvgirt

SCOP Domain Coordinates for d1bhgb1:

Click to download the PDB-style file with coordinates for d1bhgb1.
(The format of our PDB-style files is described here.)

Timeline for d1bhgb1: