SCOPe 2.06: Domain d4fyxc1: 4fyx C:1-150

Lineage for d4fyxc1 (4fyx C:1-150)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families)

5. Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins)

6. Protein Aspartate carbamoyltransferase catalytic subunit [53673] (7 species)

7. Species Escherichia coli [TaxId:562] [53674] (63 PDB entries)
   Uniprot P00479

8. Domain d4fyxc1: 4fyx C:1-150 [221617]
   Other proteins in same PDB: d4fyxb1, d4fyxb2, d4fyxd1, d4fyxd2
   automated match to d3csua1
   complexed with dcp, mg, utp, zn

Details for d4fyxc1

PDB Entry: 4fyx, 2.09 Å

PDB Description: e. coli aspartate transcarbamoylase complexed with dctp, utp, and mg2+

PDB Compounds: (C:) Aspartate carbamoyltransferase catalytic chain

SCOPe Domain Sequences for d4fyxc1:

Sequence; same for both SEQRES and ATOM records:

>d4fyxc1 c.78.1.1 (C:1-150) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]}
anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
nvpvlnagdgsnqhptqtlldlftiqetqg

Timeline for d4fyxc1:

• d4fyxc1 first appeared in SCOPe 2.03
  
• d4fyxc1 appears in SCOPe 2.05
  
• d4fyxc1 appears in SCOPe 2.07
  
• d4fyxc1 appears in the current release, SCOPe 2.08