SCOPe 2.07: Domain d4fywd1: 4fyw D:10-100

Lineage for d4fywd1 (4fyw D:10-100)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (2 families)
   automatically mapped to Pfam PF01948

5. Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)

6. Protein Aspartate carbamoyltransferase [54895] (3 species)

7. Species Escherichia coli [TaxId:562] [54896] (63 PDB entries)
   Uniprot P00478

8. Domain d4fywd1: 4fyw D:10-100 [221611]
   Other proteins in same PDB: d4fywa1, d4fywa2, d4fywb2, d4fywc1, d4fywc2, d4fywd2
   automated match to d1d09b1
   complexed with ctp, zn

Details for d4fywd1

PDB Entry: 4fyw, 2.1 Å

PDB Description: E. coli Aspartate Transcarbamoylase complexed with CTP

PDB Compounds: (D:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d4fywd1:

Sequence; same for both SEQRES and ATOM records:

>d4fywd1 d.58.2.1 (D:10-100) Aspartate carbamoyltransferase {Escherichia coli [TaxId: 562]}
eaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlikientflsed
qvdqlalyapqatvnridnyevvgksrpslp

Timeline for d4fywd1:

• d4fywd1 first appeared in SCOPe 2.03
  
• d4fywd1 appears in SCOPe 2.06
  
• d4fywd1 appears in the current release, SCOPe 2.08