SCOPe 2.04: Domain d1bhga1: 1bhg A:226-328

Lineage for d1bhga1 (1bhg A:226-328)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families)

5. Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins)

6. Protein beta-Glucuronidase [49307] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49308] (2 PDB entries)

8. Domain d1bhga1: 1bhg A:226-328 [22161]
   Other proteins in same PDB: d1bhga2, d1bhga3, d1bhgb2, d1bhgb3

Details for d1bhga1

PDB Entry: 1bhg, 2.53 Å

PDB Description: human beta-glucuronidase at 2.6 a resolution

PDB Compounds: (A:) beta-glucuronidase

SCOPe Domain Sequences for d1bhga1:

Sequence; same for both SEQRES and ATOM records:

>d1bhga1 b.1.4.1 (A:226-328) beta-Glucuronidase {Human (Homo sapiens) [TaxId: 9606]}
tyidditvttsveqdsglvnyqisvkgsnlfklevrlldaenkvvangtgtqgqlkvpgv
slwwpylmherpaylyslevqltaqtslgpvsdfytlpvgirt

Timeline for d1bhga1:

• d1bhga1 first appeared (with stable ids) in SCOP 1.55
  
• d1bhga1 appears in SCOPe 2.03
  
• d1bhga1 appears in SCOPe 2.05
  
• d1bhga1 appears in the current release, SCOPe 2.08