Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) |
Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins) |
Protein beta-Glucuronidase [49307] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49308] (1 PDB entry) |
Domain d1bhga1: 1bhg A:226-328 [22161] Other proteins in same PDB: d1bhga2, d1bhga3, d1bhgb2, d1bhgb3 |
PDB Entry: 1bhg (more details), 2.53 Å
SCOP Domain Sequences for d1bhga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bhga1 b.1.4.1 (A:226-328) beta-Glucuronidase {Human (Homo sapiens) [TaxId: 9606]} tyidditvttsveqdsglvnyqisvkgsnlfklevrlldaenkvvangtgtqgqlkvpgv slwwpylmherpaylyslevqltaqtslgpvsdfytlpvgirt
Timeline for d1bhga1: