SCOPe 2.07: Domain d4fywc1: 4fyw C:1-150

Lineage for d4fywc1 (4fyw C:1-150)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families)

5. Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins)

6. Protein Aspartate carbamoyltransferase catalytic subunit [53673] (7 species)

7. Species Escherichia coli [TaxId:562] [53674] (63 PDB entries)
   Uniprot P00479

8. Domain d4fywc1: 4fyw C:1-150 [221609]
   Other proteins in same PDB: d4fywb1, d4fywb2, d4fywd1, d4fywd2
   automated match to d3csua1
   complexed with ctp, zn

Details for d4fywc1

PDB Entry: 4fyw, 2.1 Å

PDB Description: E. coli Aspartate Transcarbamoylase complexed with CTP

PDB Compounds: (C:) Aspartate carbamoyltransferase catalytic chain

SCOPe Domain Sequences for d4fywc1:

Sequence; same for both SEQRES and ATOM records:

>d4fywc1 c.78.1.1 (C:1-150) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]}
anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
nvpvlnagdgsnqhptqtlldlftiqetqg

Timeline for d4fywc1:

• d4fywc1 first appeared in SCOPe 2.03
  
• d4fywc1 appears in SCOPe 2.06
  
• d4fywc1 appears in the current release, SCOPe 2.08