Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (2 families) automatically mapped to Pfam PF01948 |
Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein) |
Protein Aspartate carbamoyltransferase [54895] (3 species) |
Species Escherichia coli [TaxId:562] [54896] (59 PDB entries) Uniprot P00478 |
Domain d4fyvb1: 4fyv B:10-100 [221599] Other proteins in same PDB: d4fyva1, d4fyva2, d4fyvb2, d4fyvc1, d4fyvc2, d4fyvd2 automated match to d1d09b1 complexed with dcp, po4, zn |
PDB Entry: 4fyv (more details), 2.1 Å
SCOPe Domain Sequences for d4fyvb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fyvb1 d.58.2.1 (B:10-100) Aspartate carbamoyltransferase {Escherichia coli [TaxId: 562]} eaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlikientflsed qvdqlalyapqatvnridnyevvgksrpslp
Timeline for d4fyvb1: