Lineage for d4fyvb1 (4fyv B:10-100)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949509Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (2 families) (S)
    automatically mapped to Pfam PF01948
  5. 2949510Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)
  6. 2949511Protein Aspartate carbamoyltransferase [54895] (3 species)
  7. 2949512Species Escherichia coli [TaxId:562] [54896] (62 PDB entries)
    Uniprot P00478
  8. 2949556Domain d4fyvb1: 4fyv B:10-100 [221599]
    Other proteins in same PDB: d4fyva1, d4fyva2, d4fyvb2, d4fyvc1, d4fyvc2, d4fyvd2
    automated match to d1d09b1
    complexed with dcp, po4, zn

Details for d4fyvb1

PDB Entry: 4fyv (more details), 2.1 Å

PDB Description: aspartate transcarbamoylase complexed with dctp
PDB Compounds: (B:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d4fyvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fyvb1 d.58.2.1 (B:10-100) Aspartate carbamoyltransferase {Escherichia coli [TaxId: 562]}
eaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlikientflsed
qvdqlalyapqatvnridnyevvgksrpslp

SCOPe Domain Coordinates for d4fyvb1:

Click to download the PDB-style file with coordinates for d4fyvb1.
(The format of our PDB-style files is described here.)

Timeline for d4fyvb1: