SCOPe 2.08: Domain d4fxvc1: 4fxv C:20-99

Lineage for d4fxvc1 (4fxv C:20-99)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families)

5. Family d.58.7.0: automated matches [191529] (1 protein)
   not a true family

6. Protein automated matches [190896] (11 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188315] (106 PDB entries)

8. Domain d4fxvc1: 4fxv C:20-99 [221594]
   Other proteins in same PDB: d4fxva2, d4fxvb2, d4fxvc2, d4fxvd2
   automated match to d2cpja1

Details for d4fxvc1

PDB Entry: 4fxv, 1.9 Å

PDB Description: crystal structure of an elav-like protein 1 (elavl1) from homo sapiens at 1.90 a resolution

PDB Compounds: (C:) ELAV-like protein 1

SCOPe Domain Sequences for d4fxvc1:

Sequence, based on SEQRES records:

>d4fxvc1 d.58.7.0 (C:20-99) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tnlivnylpqnmtqdelrslfssigevesaklirdkvaghslgygfvnyvtakdaerain
tlnglrlqsktikvsyarps

Sequence, based on observed residues (ATOM records):

>d4fxvc1 d.58.7.0 (C:20-99) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tnlivnylpqnmtqdelrslfssigevesaklirdkghslgygfvnyvtakdaeraintl
nglrlqsktikvsyarps

Timeline for d4fxvc1:

• d4fxvc1 first appeared in SCOPe 2.03, called d4fxvc_
  
• d4fxvc1 appears in SCOPe 2.07