Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) |
Family d.58.7.0: automated matches [191529] (1 protein) not a true family |
Protein automated matches [190896] (11 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188315] (106 PDB entries) |
Domain d4fxvc1: 4fxv C:20-99 [221594] Other proteins in same PDB: d4fxva2, d4fxvb2, d4fxvc2, d4fxvd2 automated match to d2cpja1 |
PDB Entry: 4fxv (more details), 1.9 Å
SCOPe Domain Sequences for d4fxvc1:
Sequence, based on SEQRES records: (download)
>d4fxvc1 d.58.7.0 (C:20-99) automated matches {Human (Homo sapiens) [TaxId: 9606]} tnlivnylpqnmtqdelrslfssigevesaklirdkvaghslgygfvnyvtakdaerain tlnglrlqsktikvsyarps
>d4fxvc1 d.58.7.0 (C:20-99) automated matches {Human (Homo sapiens) [TaxId: 9606]} tnlivnylpqnmtqdelrslfssigevesaklirdkghslgygfvnyvtakdaeraintl nglrlqsktikvsyarps
Timeline for d4fxvc1: