Lineage for d4fw2b2 (4fw2 B:217-268)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1535986Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1537317Superfamily b.34.7: DNA-binding domain of retroviral integrase [50122] (2 families) (S)
  5. 1537338Family b.34.7.0: automated matches [227295] (1 protein)
    not a true family
  6. 1537339Protein automated matches [227120] (1 species)
    not a true protein
  7. 1537340Species Rous sarcoma virus [TaxId:11888] [226668] (2 PDB entries)
  8. 1537344Domain d4fw2b2: 4fw2 B:217-268 [221570]
    Other proteins in same PDB: d4fw2a1, d4fw2b1
    automated match to d1c0ma1

Details for d4fw2b2

PDB Entry: 4fw2 (more details), 2.65 Å

PDB Description: Crystal structure of RSV three-domain integrase with disordered N-terminal domain
PDB Compounds: (B:) integrase

SCOPe Domain Sequences for d4fw2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fw2b2 b.34.7.0 (B:217-268) automated matches {Rous sarcoma virus [TaxId: 11888]}
vltegppvkirietgewekgwnvlvwgrgyaavknrdtdkviwvpsrkvkpd

SCOPe Domain Coordinates for d4fw2b2:

Click to download the PDB-style file with coordinates for d4fw2b2.
(The format of our PDB-style files is described here.)

Timeline for d4fw2b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4fw2b1