Lineage for d1f4hc1 (1f4h C:220-333)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 9940Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) (S)
  5. 9941Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (2 proteins)
  6. 9942Protein beta-Galactosidase, domains 2 and 4 [49305] (1 species)
  7. 9943Species Escherichia coli [TaxId:562] [49306] (7 PDB entries)
  8. 10028Domain d1f4hc1: 1f4h C:220-333 [22157]
    Other proteins in same PDB: d1f4ha3, d1f4ha4, d1f4ha5, d1f4hb3, d1f4hb4, d1f4hb5, d1f4hc3, d1f4hc4, d1f4hc5, d1f4hd3, d1f4hd4, d1f4hd5

Details for d1f4hc1

PDB Entry: 1f4h (more details), 2.8 Å

PDB Description: e. coli (lacz) beta-galactosidase (orthorhombic)

SCOP Domain Sequences for d1f4hc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f4hc1 b.1.4.1 (C:220-333) beta-Galactosidase, domains 2 and 4 {Escherichia coli}
tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii
derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr

SCOP Domain Coordinates for d1f4hc1:

Click to download the PDB-style file with coordinates for d1f4hc1.
(The format of our PDB-style files is described here.)

Timeline for d1f4hc1: