SCOPe 2.04: Domain d4fw2b1: 4fw2 B:54-216

Lineage for d4fw2b1 (4fw2 B:54-216)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)

6. Protein automated matches [190209] (7 species)
   not a true protein

7. Species Rous sarcoma virus [TaxId:11888] [226667] (2 PDB entries)

8. Domain d4fw2b1: 4fw2 B:54-216 [221569]
   Other proteins in same PDB: d4fw2a2, d4fw2b2
   automated match to d1c0ma2

Details for d4fw2b1

PDB Entry: 4fw2, 2.65 Å

PDB Description: Crystal structure of RSV three-domain integrase with disordered N-terminal domain

PDB Compounds: (B:) integrase

SCOPe Domain Sequences for d4fw2b1:

Sequence, based on SEQRES records:

>d4fw2b1 c.55.3.2 (B:54-216) automated matches {Rous sarcoma virus [TaxId: 11888]}
glgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvavqhhwataiavlg
rpkaiktdngscftskstrewlarwgiahttgipgnsqgqamveranrllkdkirvlaeg
dgfmkriptskqgellakamyalnhkergentktpiqkhwrpt

Sequence, based on observed residues (ATOM records):

>d4fw2b1 c.55.3.2 (B:54-216) automated matches {Rous sarcoma virus [TaxId: 11888]}
glgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvavqhhwataiavlg
rpkaiktdngscftskstrewlarwgiahttgiamveranrllkdkirvlaegdgfmkri
ptskqgellakamyalnhkergenktpiqkhwrpt

Timeline for d4fw2b1:

• d4fw2b1 first appeared in SCOPe 2.03
  
• d4fw2b1 appears in SCOPe 2.05
  
• d4fw2b1 appears in the current release, SCOPe 2.08