| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) ![]() consists of one domain of this fold |
| Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins) |
| Protein automated matches [190209] (7 species) not a true protein |
| Species Rous sarcoma virus [TaxId:11888] [226667] (2 PDB entries) |
| Domain d4fw1b1: 4fw1 B:54-216 [221565] Other proteins in same PDB: d4fw1a2, d4fw1b2 automated match to d1c0ma2 |
PDB Entry: 4fw1 (more details), 1.86 Å
SCOPe Domain Sequences for d4fw1b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fw1b1 c.55.3.2 (B:54-216) automated matches {Rous sarcoma virus [TaxId: 11888]}
glgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvavqhhwataiavlg
rpkaiktdngdaftskstrewlarwgiahttgipgnsqgqamvcranrllkdkirvlaeg
dgfmkriptskqgellakamyalnhkergentktpiqkhwrpt
Timeline for d4fw1b1: