| Class b: All beta proteins [48724] (178 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.7: DNA-binding domain of retroviral integrase [50122] (2 families) ![]() |
| Family b.34.7.0: automated matches [227295] (1 protein) not a true family |
| Protein automated matches [227120] (1 species) not a true protein |
| Species Rous sarcoma virus [TaxId:11888] [226668] (2 PDB entries) |
| Domain d4fw1a2: 4fw1 A:217-269 [221564] Other proteins in same PDB: d4fw1a1, d4fw1b1 automated match to d1c0ma1 |
PDB Entry: 4fw1 (more details), 1.86 Å
SCOPe Domain Sequences for d4fw1a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fw1a2 b.34.7.0 (A:217-269) automated matches {Rous sarcoma virus [TaxId: 11888]}
vltegppvkirietgewekgwnvlvwgrgyaavknrdtdkviwvpsrkvkpdi
Timeline for d4fw1a2: