SCOPe 2.08: Domain d4fw1a2: 4fw1 A:217-269

Lineage for d4fw1a2 (4fw1 A:217-269)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.7: DNA-binding domain of retroviral integrase [50122] (2 families)

5. Family b.34.7.0: automated matches [227295] (1 protein)
   not a true family

6. Protein automated matches [227120] (1 species)
   not a true protein

7. Species Rous sarcoma virus [TaxId:11888] [226668] (2 PDB entries)

8. Domain d4fw1a2: 4fw1 A:217-269 [221564]
   Other proteins in same PDB: d4fw1a1, d4fw1b1
   automated match to d1c0ma1

Details for d4fw1a2

PDB Entry: 4fw1, 1.86 Å

PDB Description: crystal structure of two-domain rsv integrase covalently linked with dna

PDB Compounds: (A:) integrase

SCOPe Domain Sequences for d4fw1a2:

Sequence; same for both SEQRES and ATOM records:

>d4fw1a2 b.34.7.0 (A:217-269) automated matches {Rous sarcoma virus [TaxId: 11888]}
vltegppvkirietgewekgwnvlvwgrgyaavknrdtdkviwvpsrkvkpdi

Timeline for d4fw1a2:

• d4fw1a2 first appeared in SCOPe 2.03
  
• d4fw1a2 appears in SCOPe 2.07