Lineage for d4fw1a1 (4fw1 A:52-216)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2493668Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) (S)
    consists of one domain of this fold
  5. 2493948Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)
  6. 2494110Protein automated matches [190209] (5 species)
    not a true protein
  7. 2494291Species Rous sarcoma virus [TaxId:11888] [226667] (2 PDB entries)
  8. 2494292Domain d4fw1a1: 4fw1 A:52-216 [221563]
    Other proteins in same PDB: d4fw1a2, d4fw1b2
    automated match to d1c0ma2

Details for d4fw1a1

PDB Entry: 4fw1 (more details), 1.86 Å

PDB Description: crystal structure of two-domain rsv integrase covalently linked with dna
PDB Compounds: (A:) integrase

SCOPe Domain Sequences for d4fw1a1:

Sequence, based on SEQRES records: (download)

>d4fw1a1 c.55.3.2 (A:52-216) automated matches {Rous sarcoma virus [TaxId: 11888]}
prglgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvavqhhwataiav
lgrpkaiktdngdaftskstrewlarwgiahttgipgnsqgqamvcranrllkdkirvla
egdgfmkriptskqgellakamyalnhkergentktpiqkhwrpt

Sequence, based on observed residues (ATOM records): (download)

>d4fw1a1 c.55.3.2 (A:52-216) automated matches {Rous sarcoma virus [TaxId: 11888]}
prglgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvavqhhwataiav
lgrpkaiktdngdaftskstrewlarwgiahttgamvcranrllkdkirvlaegdgfmkr
iptskqgellakamyalnhkergentktpiqkhwrpt

SCOPe Domain Coordinates for d4fw1a1:

Click to download the PDB-style file with coordinates for d4fw1a1.
(The format of our PDB-style files is described here.)

Timeline for d4fw1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4fw1a2