Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) consists of one domain of this fold |
Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins) Pfam PF00665 |
Protein automated matches [190209] (5 species) not a true protein |
Species Rous sarcoma virus [TaxId:11888] [226667] (2 PDB entries) |
Domain d4fw1a1: 4fw1 A:52-216 [221563] Other proteins in same PDB: d4fw1a2, d4fw1b2 automated match to d1c0ma2 |
PDB Entry: 4fw1 (more details), 1.86 Å
SCOPe Domain Sequences for d4fw1a1:
Sequence, based on SEQRES records: (download)
>d4fw1a1 c.55.3.2 (A:52-216) automated matches {Rous sarcoma virus [TaxId: 11888]} prglgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvavqhhwataiav lgrpkaiktdngdaftskstrewlarwgiahttgipgnsqgqamvcranrllkdkirvla egdgfmkriptskqgellakamyalnhkergentktpiqkhwrpt
>d4fw1a1 c.55.3.2 (A:52-216) automated matches {Rous sarcoma virus [TaxId: 11888]} prglgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvavqhhwataiav lgrpkaiktdngdaftskstrewlarwgiahttgamvcranrllkdkirvlaegdgfmkr iptskqgellakamyalnhkergentktpiqkhwrpt
Timeline for d4fw1a1: