![]() | Class b: All beta proteins [48724] (93 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) ![]() |
![]() | Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (2 proteins) |
![]() | Protein beta-Galactosidase, domains 2 and 4 [49305] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [49306] (7 PDB entries) |
![]() | Domain d1f4ha2: 1f4h A:626-730 [22154] Other proteins in same PDB: d1f4ha3, d1f4ha4, d1f4ha5, d1f4hb3, d1f4hb4, d1f4hb5, d1f4hc3, d1f4hc4, d1f4hc5, d1f4hd3, d1f4hd4, d1f4hd5 |
PDB Entry: 1f4h (more details), 2.8 Å
SCOP Domain Sequences for d1f4ha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f4ha2 b.1.4.1 (A:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli} ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl
Timeline for d1f4ha2:
![]() Domains from same chain: (mouse over for more information) d1f4ha1, d1f4ha3, d1f4ha4, d1f4ha5 |