SCOPe 2.03: Domain d4fuga_: 4fug A:

Lineage for d4fuga_ (4fug A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein Urokinase-type plasminogen activator (LMW U-PA), catalytic domain [50586] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50587] (63 PDB entries)
   Uniprot P00749 156-178,179-424

8. Domain d4fuga_: 4fug A: [221531]
   automated match to d4fuba_
   complexed with 9up, act, gol, so4

Details for d4fuga_

PDB Entry: 4fug, 1.8 Å

PDB Description: Crystal Structure of the Urokinase

PDB Compounds: (A:) urokinase-type plasminogen activator

SCOPe Domain Sequences for d4fuga_:

Sequence; same for both SEQRES and ATOM records:

>d4fuga_ b.47.1.2 (A:) Urokinase-type plasminogen activator (LMW U-PA), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
iiggefttienqpwfaaiyrrhrggsvtyvcggslispcwvisathcfidypkkedyivy
lgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrcaqpsrtiqti
alpsmyndpqfgtsceitgfgkeqstdylypeqlkmtvvklishrecqqphyygsevttk
mlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpw
irshtk

Timeline for d4fuga_:

• d4fuga_ is new in SCOPe 2.03-stable
  
• d4fuga_ appears in SCOPe 2.04
  
• d4fuga_ appears in the current release, SCOPe 2.08