SCOPe 2.06: Domain d1f4ha1: 1f4h A:220-333

Lineage for d1f4ha1 (1f4h A:220-333)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families)

5. Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins)

6. Protein beta-Galactosidase, domains 2 and 4 [49305] (2 species)

7. Species Escherichia coli [TaxId:562] [49306] (42 PDB entries)
   Uniprot P00722

8. Domain d1f4ha1: 1f4h A:220-333 [22153]
   Other proteins in same PDB: d1f4ha3, d1f4ha4, d1f4ha5, d1f4hb3, d1f4hb4, d1f4hb5, d1f4hc3, d1f4hc4, d1f4hc5, d1f4hd3, d1f4hd4, d1f4hd5
   complexed with mg

Details for d1f4ha1

PDB Entry: 1f4h, 2.8 Å

PDB Description: e. coli (lacz) beta-galactosidase (orthorhombic)

PDB Compounds: (A:) beta-galactosidase

SCOPe Domain Sequences for d1f4ha1:

Sequence; same for both SEQRES and ATOM records:

>d1f4ha1 b.1.4.1 (A:220-333) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]}
tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii
derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr

Timeline for d1f4ha1:

• d1f4ha1 first appeared (with stable ids) in SCOP 1.55
  
• d1f4ha1 appears in SCOPe 2.05
  
• d1f4ha1 appears in SCOPe 2.07
  
• d1f4ha1 appears in the current release, SCOPe 2.08