SCOPe 2.08: Domain d4fu0a2: 4fu0 A:139-348

Lineage for d4fu0a2 (4fu0 A:139-348)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families)

5. Family d.142.1.0: automated matches [227184] (1 protein)
   not a true family

6. Protein automated matches [226904] (39 species)
   not a true protein

7. Species Enterococcus faecalis [TaxId:1351] [226474] (1 PDB entry)

8. Domain d4fu0a2: 4fu0 A:139-348 [221520]
   Other proteins in same PDB: d4fu0a1, d4fu0b1
   automated match to d1e4ea2
   complexed with adp, so4

Details for d4fu0a2

PDB Entry: 4fu0, 2.35 Å

PDB Description: Crystal Structure of VanG D-Ala:D-Ser Ligase from Enterococcus faecalis

PDB Compounds: (A:) D-alanine--D-alanine ligase 7

SCOPe Domain Sequences for d4fu0a2:

Sequence; same for both SEQRES and ATOM records:

>d4fu0a2 d.142.1.0 (A:139-348) automated matches {Enterococcus faecalis [TaxId: 1351]}
dkdrahklvslagisvpksvtfkrfneeaamkeieanltyplfikpvragssfgitkvie
kqeldaaielafehdteviveetingfevgcavlgidelivgrvdeielssgffdyteky
tlksskiymparidaeaekriqeaavtiykalgcsgfsrvdmfytpsgeivfnevntipg
ftshsrypnmmkgiglsfsqmldkliglyv

Timeline for d4fu0a2:

• d4fu0a2 first appeared in SCOPe 2.03
  
• d4fu0a2 appears in SCOPe 2.07