Lineage for d1f4ad2 (1f4a D:626-730)
- Root: SCOP 1.63
Class b: All beta proteins [48724] (119 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) 
Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (2 proteins) Protein beta-Galactosidase, domains 2 and 4 [49305] (1 species) Species Escherichia coli [TaxId:562] [49306] (23 PDB entries) 
Domain d1f4ad2: 1f4a D:626-730 [22152]
Other proteins in same PDB: d1f4aa3, d1f4aa4, d1f4aa5, d1f4ab3, d1f4ab4, d1f4ab5, d1f4ac3, d1f4ac4, d1f4ac5, d1f4ad3, d1f4ad4, d1f4ad5
complexed with mg
Details for d1f4ad2
PDB Entry: 1f4a (more details), 2.8 Å
PDB Description: e. coli (lacz) beta-galactosidase (ncs constrained monomer- orthorhombic)
SCOP Domain Sequences for d1f4ad2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f4ad2 b.1.4.1 (D:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl
SCOP Domain Coordinates for d1f4ad2:
Click to download the PDB-style file with coordinates for d1f4ad2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1f4ad2:
- d1f4ad2 first appeared (with stable ids) in SCOP 1.55
- d1f4ad2 appears in SCOP 1.61
- d1f4ad2 appears in SCOP 1.65
- d1f4ad2 appears in the current release, SCOPe 2.08
 View in 3DDomains from same chain: (mouse over for more information) d1f4ad1, d1f4ad3, d1f4ad4, d1f4ad5 |
