| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) ![]() precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
| Family c.30.1.0: automated matches [227183] (1 protein) not a true family |
| Protein automated matches [226903] (40 species) not a true protein |
| Species Enterococcus faecalis [TaxId:1351] [226473] (1 PDB entry) |
| Domain d4fu0a1: 4fu0 A:2-138 [221519] Other proteins in same PDB: d4fu0a2, d4fu0b2 automated match to d1e4ea1 complexed with adp, so4 |
PDB Entry: 4fu0 (more details), 2.35 Å
SCOPe Domain Sequences for d4fu0a1:
Sequence, based on SEQRES records: (download)
>d4fu0a1 c.30.1.0 (A:2-138) automated matches {Enterococcus faecalis [TaxId: 1351]}
qnkkiavifggnsteyevslqsasavfenintnkfdiipigitrsgewyhytgekekiln
ntwfedsknlcpvvvsqnrsvkgfleiasdkyriikvdlvfpvlhgkngedgtlqgifel
agipvvgcdtlssalcm
>d4fu0a1 c.30.1.0 (A:2-138) automated matches {Enterococcus faecalis [TaxId: 1351]}
qnkkiavifggnsteyevslqsasavfenintnkfdiipigitrsgewyhytgekekiln
ntwfedsknlcpvvvsqnrsvkgfleiyriikvdlvfpvlhgkngedgtlqgifelagip
vvgcdtlssalcm
Timeline for d4fu0a1: