SCOPe 2.08: Domain d4fu0a1: 4fu0 A:2-138

Lineage for d4fu0a1 (4fu0 A:2-138)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (10 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.0: automated matches [227183] (1 protein)
   not a true family

6. Protein automated matches [226903] (40 species)
   not a true protein

7. Species Enterococcus faecalis [TaxId:1351] [226473] (1 PDB entry)

8. Domain d4fu0a1: 4fu0 A:2-138 [221519]
   Other proteins in same PDB: d4fu0a2, d4fu0b2
   automated match to d1e4ea1
   complexed with adp, so4

Details for d4fu0a1

PDB Entry: 4fu0, 2.35 Å

PDB Description: Crystal Structure of VanG D-Ala:D-Ser Ligase from Enterococcus faecalis

PDB Compounds: (A:) D-alanine--D-alanine ligase 7

SCOPe Domain Sequences for d4fu0a1:

Sequence, based on SEQRES records:

>d4fu0a1 c.30.1.0 (A:2-138) automated matches {Enterococcus faecalis [TaxId: 1351]}
qnkkiavifggnsteyevslqsasavfenintnkfdiipigitrsgewyhytgekekiln
ntwfedsknlcpvvvsqnrsvkgfleiasdkyriikvdlvfpvlhgkngedgtlqgifel
agipvvgcdtlssalcm

Sequence, based on observed residues (ATOM records):

>d4fu0a1 c.30.1.0 (A:2-138) automated matches {Enterococcus faecalis [TaxId: 1351]}
qnkkiavifggnsteyevslqsasavfenintnkfdiipigitrsgewyhytgekekiln
ntwfedsknlcpvvvsqnrsvkgfleiyriikvdlvfpvlhgkngedgtlqgifelagip
vvgcdtlssalcm

Timeline for d4fu0a1:

• d4fu0a1 first appeared in SCOPe 2.03
  
• d4fu0a1 appears in SCOPe 2.07