SCOPe 2.03: Domain d1f4ad1: 1f4a D:220-333

Lineage for d1f4ad1 (1f4a D:220-333)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family)

5. Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins)

6. Protein beta-Galactosidase, domains 2 and 4 [49305] (2 species)

7. Species Escherichia coli [TaxId:562] [49306] (25 PDB entries)
   Uniprot P00722

8. Domain d1f4ad1: 1f4a D:220-333 [22151]
   Other proteins in same PDB: d1f4aa3, d1f4aa4, d1f4aa5, d1f4ab3, d1f4ab4, d1f4ab5, d1f4ac3, d1f4ac4, d1f4ac5, d1f4ad3, d1f4ad4, d1f4ad5
   complexed with mg

Details for d1f4ad1

PDB Entry: 1f4a, 2.8 Å

PDB Description: e. coli (lacz) beta-galactosidase (ncs constrained monomer- orthorhombic)

PDB Compounds: (D:) beta-galactosidase

SCOPe Domain Sequences for d1f4ad1:

Sequence; same for both SEQRES and ATOM records:

>d1f4ad1 b.1.4.1 (D:220-333) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]}
tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii
derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr

Timeline for d1f4ad1:

• d1f4ad1 first appeared (with stable ids) in SCOP 1.55
  
• d1f4ad1 appears in SCOPe 2.02
  
• d1f4ad1 appears in SCOPe 2.04
  
• d1f4ad1 appears in the current release, SCOPe 2.08