Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.1: Actin/HSP70 [53068] (8 proteins) |
Protein automated matches [226905] (13 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225574] (51 PDB entries) |
Domain d4fsva1: 4fsv A:4-189 [221502] automated match to d1atra1 |
PDB Entry: 4fsv (more details), 1.8 Å
SCOPe Domain Sequences for d4fsva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fsva1 c.55.1.1 (A:4-189) automated matches {Human (Homo sapiens) [TaxId: 9606]} rgpaigidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvamn ptntifdakrligrkfedatvqsdmkhwpfrvvseggkpkvqveykgetktffpeeissm vltkmkeiaeaylggkvhsavitvpayfndsqrqatkdagtitglnvlriineptaaaia ygldkk
Timeline for d4fsva1: