Lineage for d4fsva1 (4fsv A:4-189)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2883385Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 2883861Protein automated matches [226905] (13 species)
    not a true protein
  7. 2883942Species Human (Homo sapiens) [TaxId:9606] [225574] (54 PDB entries)
  8. 2883999Domain d4fsva1: 4fsv A:4-189 [221502]
    automated match to d1atra1

Details for d4fsva1

PDB Entry: 4fsv (more details), 1.8 Å

PDB Description: crystal structure of a heat shock 70kda protein 2 (hspa2) from homo sapiens at 1.80 a resolution
PDB Compounds: (A:) Heat shock-related 70 kDa protein 2

SCOPe Domain Sequences for d4fsva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fsva1 c.55.1.1 (A:4-189) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rgpaigidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvamn
ptntifdakrligrkfedatvqsdmkhwpfrvvseggkpkvqveykgetktffpeeissm
vltkmkeiaeaylggkvhsavitvpayfndsqrqatkdagtitglnvlriineptaaaia
ygldkk

SCOPe Domain Coordinates for d4fsva1:

Click to download the PDB-style file with coordinates for d4fsva1.
(The format of our PDB-style files is described here.)

Timeline for d4fsva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4fsva2