SCOPe 2.08: Domain d4fsva1: 4fsv A:4-189

Lineage for d4fsva1 (4fsv A:4-189)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein automated matches [226905] (13 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225574] (54 PDB entries)

8. Domain d4fsva1: 4fsv A:4-189 [221502]
   automated match to d1atra1

Details for d4fsva1

PDB Entry: 4fsv, 1.8 Å

PDB Description: crystal structure of a heat shock 70kda protein 2 (hspa2) from homo sapiens at 1.80 a resolution

PDB Compounds: (A:) Heat shock-related 70 kDa protein 2

SCOPe Domain Sequences for d4fsva1:

Sequence; same for both SEQRES and ATOM records:

>d4fsva1 c.55.1.1 (A:4-189) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rgpaigidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvamn
ptntifdakrligrkfedatvqsdmkhwpfrvvseggkpkvqveykgetktffpeeissm
vltkmkeiaeaylggkvhsavitvpayfndsqrqatkdagtitglnvlriineptaaaia
ygldkk

Timeline for d4fsva1:

• d4fsva1 first appeared in SCOPe 2.03
  
• d4fsva1 appears in SCOPe 2.07