SCOPe 2.08: Domain d4fshb2: 4fsh B:105-263

Lineage for d4fshb2 (4fsh B:105-263)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:85962] [226244] (12 PDB entries)

8. Domain d4fshb2: 4fsh B:105-263 [221494]
   Other proteins in same PDB: d4fsha1, d4fshb1
   automated match to d1p77a1
   complexed with skm

Details for d4fshb2

PDB Entry: 4fsh, 2.85 Å

PDB Description: Crystal Structure of Shikimate Dehydrogenase (aroE) Clinical Variant v2356 from Helicobacter pylori in Complex with Shikimate

PDB Compounds: (B:) Shikimate dehydrogenase

SCOPe Domain Sequences for d4fshb2:

Sequence; same for both SEQRES and ATOM records:

>d4fshb2 c.2.1.0 (B:105-263) automated matches {Helicobacter pylori [TaxId: 85962]}
dalgfylslkhqnyqnalilgsggsakalacglkkqglkvsvlnrsprgldffqrlgcdc
fmeppksafdliinatsaslnnelplnkevlkgyfkeaklaydlaygfltpflalakelk
ipfqdgkdmliyqaslsfekfsasqipyskafevmrsvf

Timeline for d4fshb2:

• d4fshb2 first appeared in SCOPe 2.03
  
• d4fshb2 appears in SCOPe 2.07