Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) |
Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins) |
Protein automated matches [190079] (12 species) not a true protein |
Species Enterobacter cloacae [TaxId:550] [226695] (4 PDB entries) |
Domain d4fsbb_: 4fsb B: [221490] automated match to d2yz3a1 complexed with cl, zn |
PDB Entry: 4fsb (more details), 1.88 Å
SCOPe Domain Sequences for d4fsbb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fsbb_ d.157.1.1 (B:) automated matches {Enterobacter cloacae [TaxId: 550]} geyptvseipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawgak ntaallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaevegnei pthsleglsssgdavrfgpvelfypgaahstdnlvvyvpsasvlyggcaihelsrtsagn vadadlaewptsieriqqrypeaqfvipghglpggldllkhttnvvkahtnr
Timeline for d4fsbb_: