Lineage for d4fsba_ (4fsb A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2602905Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2602906Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2602907Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 2603069Protein automated matches [190079] (12 species)
    not a true protein
  7. 2603106Species Enterobacter cloacae [TaxId:550] [226695] (4 PDB entries)
  8. 2603110Domain d4fsba_: 4fsb A: [221489]
    automated match to d2yz3a1
    complexed with cl, zn

Details for d4fsba_

PDB Entry: 4fsb (more details), 1.88 Å

PDB Description: crystal structure of the metallo-beta-lactamase vim-31 in its oxidized form at 1.88 a
PDB Compounds: (A:) Metallo-beta-lactamase VIM-31

SCOPe Domain Sequences for d4fsba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fsba_ d.157.1.1 (A:) automated matches {Enterobacter cloacae [TaxId: 550]}
geyptvseipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawgak
ntaallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaevegnei
pthsleglsssgdavrfgpvelfypgaahstdnlvvyvpsasvlyggcaihelsrtsagn
vadadlaewptsieriqqrypeaqfvipghglpggldllkhttnvvkahtnr

SCOPe Domain Coordinates for d4fsba_:

Click to download the PDB-style file with coordinates for d4fsba_.
(The format of our PDB-style files is described here.)

Timeline for d4fsba_: