Lineage for d4frzb_ (4frz B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2111568Family c.37.1.9: Motor proteins [52641] (5 protein domains)
  6. 2111709Protein automated matches [190129] (6 species)
    not a true protein
  7. 2111787Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188907] (2 PDB entries)
  8. 2111790Domain d4frzb_: 4frz B: [221487]
    automated match to d3h4sa1
    complexed with adp, edo, imd, mg

Details for d4frzb_

PDB Entry: 4frz (more details), 2.4 Å

PDB Description: Arabidopsis KCBP motor domain dimerized via regulatory domain
PDB Compounds: (B:) Kinesin-like calmodulin-binding protein

SCOPe Domain Sequences for d4frzb_:

Sequence, based on SEQRES records: (download)

>d4frzb_ c.37.1.9 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
kryyntiedmkgkirvycrirplnekesserekqmlttvdeftvehpwkddkrkqhiydr
vfdmrasqddifedtkylvqsavdgynvcifaygqtgsgktftiyghesnpgltpratke
lfnilkrdskrfsfslkaymvelyqdtlvdlllpksarrlkleikkdskgmvfvenvtti
pistleelrmilergserrhvsgtnmneessrshlilsvviesidlqtqsaargklsfvd
lagservkksgsagnqlkeaqsinkslsalgdvigalssgnqhipyrnhkltmlmsdslg
gnaktlmfvnvspaesnldetynsllyasrvrtivndpskhisskemvrlkklvaywkeq
agkkgeeedlvdieed

Sequence, based on observed residues (ATOM records): (download)

>d4frzb_ c.37.1.9 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
kryyntiedmkgkirvycrirplnekesserekqmlttvdeftvehpwkddkrkqhiydr
vfdmrasqddifedtkylvqsavdgynvcifaygqtgsgktftiyghesnpgltpratke
lfnilkrdskrfsfslkaymvelyqdtlvdlllpksarrlkleikkdskgmvfvenvtti
pistleelrmilergserrhvessrshlilsvviesidlqtqsaargklsfvdlagseri
nkslsalgdvigalssgnqhipyrnhkltmlmsdslggnaktlmfvnvspaesnldetyn
sllyasrvrtivndpskhisskemvrlkklvaywkeqagkedlvdieed

SCOPe Domain Coordinates for d4frzb_:

Click to download the PDB-style file with coordinates for d4frzb_.
(The format of our PDB-style files is described here.)

Timeline for d4frzb_: