Class b: All beta proteins [48724] (176 folds) |
Fold b.62: Cyclophilin-like [50890] (1 superfamily) barrel, closed; n=8, S=10; complex topology |
Superfamily b.62.1: Cyclophilin-like [50891] (5 families) |
Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins) automatically mapped to Pfam PF00160 |
Protein automated matches [190077] (18 species) not a true protein |
Species Horse (Equus caballus) [TaxId:9796] [226528] (2 PDB entries) |
Domain d4frua_: 4fru A: [221484] automated match to d3icia_ complexed with me2, peg, zn |
PDB Entry: 4fru (more details), 1.1 Å
SCOPe Domain Sequences for d4frua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4frua_ b.62.1.1 (A:) automated matches {Horse (Equus caballus) [TaxId: 9796]} amdekkkgpkvtvkvyfdlrigdedigrvviglfgktvpktvdnfvalatgekgfgykds kfhrvikdfmiqggdftrgdgtggksiygerfpdenfklkhygpgwvsmanagkdtngsq ffittvktawldgkhvvfgkvlegmevvrkvettktdgrdkplkdvtiadcgkievekpf aiake
Timeline for d4frua_: