Lineage for d1f4ab2 (1f4a B:626-730)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 9940Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) (S)
  5. 9941Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (2 proteins)
  6. 9942Protein beta-Galactosidase, domains 2 and 4 [49305] (1 species)
  7. 9943Species Escherichia coli [TaxId:562] [49306] (7 PDB entries)
  8. 10019Domain d1f4ab2: 1f4a B:626-730 [22148]
    Other proteins in same PDB: d1f4aa3, d1f4aa4, d1f4aa5, d1f4ab3, d1f4ab4, d1f4ab5, d1f4ac3, d1f4ac4, d1f4ac5, d1f4ad3, d1f4ad4, d1f4ad5

Details for d1f4ab2

PDB Entry: 1f4a (more details), 2.8 Å

PDB Description: e. coli (lacz) beta-galactosidase (ncs constrained monomer- orthorhombic)

SCOP Domain Sequences for d1f4ab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f4ab2 b.1.4.1 (B:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl

SCOP Domain Coordinates for d1f4ab2:

Click to download the PDB-style file with coordinates for d1f4ab2.
(The format of our PDB-style files is described here.)

Timeline for d1f4ab2: