Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (159 species) not a true protein |
Species Helicobacter pylori [TaxId:85962] [226244] (12 PDB entries) |
Domain d4fr5a2: 4fr5 A:105-263 [221476] Other proteins in same PDB: d4fr5a1, d4fr5b1 automated match to d1p77a1 complexed with skm; mutant |
PDB Entry: 4fr5 (more details), 2.2 Å
SCOPe Domain Sequences for d4fr5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fr5a2 c.2.1.0 (A:105-263) automated matches {Helicobacter pylori [TaxId: 85962]} dalgfylslkqknyqnalilgaggsakalacelkkqglqvsvlnrssrgldffqrlgcdc fmeppksafdliinatsaslhnelplnkevlkgyfkegklaydlasgfltpflslakelk tpfqdgkdmliyqaalsfekfsasqipyskafevmrsvf
Timeline for d4fr5a2: