Lineage for d4fqxd2 (4fqx D:94-193)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2751188Domain d4fqxd2: 4fqx D:94-193 [221473]
    Other proteins in same PDB: d4fqxa1, d4fqxa2, d4fqxb1, d4fqxb3, d4fqxc1, d4fqxc3, d4fqxd1
    automated match to d1hdmb1

Details for d4fqxd2

PDB Entry: 4fqx (more details), 2.6 Å

PDB Description: crystal structure of hla-dm bound to hla-dr1
PDB Compounds: (D:) HLA class II histocompatibility antigen, DM beta chain

SCOPe Domain Sequences for d4fqxd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fqxd2 b.1.1.2 (D:94-193) automated matches {Human (Homo sapiens) [TaxId: 9606]}
trppsvqvakttpfntrepvmlacyvwgfypaevtitwrkngklvmphssahktaqpngd
wtyqtlshlaltpsygdtytcvvehigapepilrdwtpgl

SCOPe Domain Coordinates for d4fqxd2:

Click to download the PDB-style file with coordinates for d4fqxd2.
(The format of our PDB-style files is described here.)

Timeline for d4fqxd2: