SCOPe 2.06: Domain d4fqxb1: 4fqx B:1-92

Lineage for d4fqxb1 (4fqx B:1-92)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein automated matches [191280] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189896] (32 PDB entries)

8. Domain d4fqxb1: 4fqx B:1-92 [221468]
   Other proteins in same PDB: d4fqxa1, d4fqxa2, d4fqxb2, d4fqxb3, d4fqxc2, d4fqxc3, d4fqxd2
   automated match to d1klub2

Details for d4fqxb1

PDB Entry: 4fqx, 2.6 Å

PDB Description: crystal structure of hla-dm bound to hla-dr1

PDB Compounds: (B:) HLA class II histocompatibility antigen, DRB1-1 beta chain

SCOPe Domain Sequences for d4fqxb1:

Sequence; same for both SEQRES and ATOM records:

>d4fqxb1 d.19.1.1 (B:1-92) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gdtrprflwqlkfechffngtervrllersiynqeesvrfdsdvgeyravtelgrpdaey
wnsqkdlleqrraavdtycrhnygvgesftvq

Timeline for d4fqxb1:

• d4fqxb1 first appeared in SCOPe 2.03
  
• d4fqxb1 appears in SCOPe 2.05
  
• d4fqxb1 appears in SCOPe 2.07
  
• d4fqxb1 appears in the current release, SCOPe 2.08