Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein automated matches [191280] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189896] (24 PDB entries) |
Domain d4fqxb1: 4fqx B:-5-92 [221468] Other proteins in same PDB: d4fqxa1, d4fqxa2, d4fqxb2, d4fqxc2, d4fqxd2 automated match to d1klub2 |
PDB Entry: 4fqx (more details), 2.6 Å
SCOPe Domain Sequences for d4fqxb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fqxb1 d.19.1.1 (B:-5-92) automated matches {Human (Homo sapiens) [TaxId: 9606]} vlfqgpgdtrprflwqlkfechffngtervrllersiynqeesvrfdsdvgeyravtelg rpdaeywnsqkdlleqrraavdtycrhnygvgesftvq
Timeline for d4fqxb1: