Lineage for d4fqxa2 (4fqx A:82-181)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026644Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2026645Protein automated matches [190740] (27 species)
    not a true protein
  7. 2026747Species Human (Homo sapiens) [TaxId:9606] [187920] (889 PDB entries)
  8. 2027429Domain d4fqxa2: 4fqx A:82-181 [221467]
    Other proteins in same PDB: d4fqxa1, d4fqxb1, d4fqxb2, d4fqxb3, d4fqxc1, d4fqxc2, d4fqxc3, d4fqxd1, d4fqxd2
    automated match to d1ieaa1

Details for d4fqxa2

PDB Entry: 4fqx (more details), 2.6 Å

PDB Description: Crystal structure of HLA-DM bound to HLA-DR1
PDB Compounds: (A:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d4fqxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fqxa2 b.1.1.0 (A:82-181) automated matches {Human (Homo sapiens) [TaxId: 9606]}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwefd

SCOPe Domain Coordinates for d4fqxa2:

Click to download the PDB-style file with coordinates for d4fqxa2.
(The format of our PDB-style files is described here.)

Timeline for d4fqxa2: