SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4fqxa2 (4fqx A:82-181)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026644Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2026645Protein automated matches [190740] (24 species)
    not a true protein
  7. 2026747Species Human (Homo sapiens) [TaxId:9606] [187920] (786 PDB entries)
  8. 2027429Domain d4fqxa2: 4fqx A:82-181 [221467]
    Other proteins in same PDB: d4fqxa1, d4fqxb1, d4fqxb2, d4fqxb3, d4fqxc1, d4fqxc2, d4fqxc3, d4fqxd1, d4fqxd2
    automated match to d1ieaa1

Details for d4fqxa2

PDB Entry: 4fqx (more details), 2.6 Å

PDB Description: Crystal structure of HLA-DM bound to HLA-DR1
PDB Compounds: (A:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d4fqxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fqxa2 b.1.1.0 (A:82-181) automated matches {Human (Homo sapiens) [TaxId: 9606]}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwefd

SCOPe Domain Coordinates for d4fqxa2:

Click to download the PDB-style file with coordinates for d4fqxa2.
(The format of our PDB-style files is described here.)

Timeline for d4fqxa2: