Lineage for d4fqxa1 (4fqx A:2-81)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2506503Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2506504Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2507530Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2507531Protein automated matches [226842] (4 species)
    not a true protein
  7. 2507544Species Human (Homo sapiens) [TaxId:9606] [226044] (67 PDB entries)
  8. 2507640Domain d4fqxa1: 4fqx A:2-81 [221466]
    Other proteins in same PDB: d4fqxa2, d4fqxb1, d4fqxb2, d4fqxb3, d4fqxc1, d4fqxc2, d4fqxc3, d4fqxd1, d4fqxd2
    automated match to d1fnga2
    complexed with nag

Details for d4fqxa1

PDB Entry: 4fqx (more details), 2.6 Å

PDB Description: crystal structure of hla-dm bound to hla-dr1
PDB Compounds: (A:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d4fqxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fqxa1 d.19.1.0 (A:2-81) automated matches {Human (Homo sapiens) [TaxId: 9606]}
keehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgala
niacdkanleimtkrsnytp

SCOPe Domain Coordinates for d4fqxa1:

Click to download the PDB-style file with coordinates for d4fqxa1.
(The format of our PDB-style files is described here.)

Timeline for d4fqxa1: