SCOPe 2.08: Domain d4fqqe2: 4fqq E:109-209

Lineage for d4fqqe2 (4fqq E:109-209)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d4fqqe2: 4fqq E:109-209 [221461]
   Other proteins in same PDB: d4fqqa1, d4fqqb1, d4fqqb2, d4fqqc1, d4fqqd1, d4fqqd2, d4fqqe1, d4fqqf1, d4fqqf2, d4fqqh1, d4fqqh2, d4fqql1
   automated match to d1adql2
   complexed with na

Details for d4fqqe2

PDB Entry: 4fqq, 2.42 Å

PDB Description: crystal structure of germline antibody pgt121-gl fab

PDB Compounds: (E:) Fab light chain

SCOPe Domain Sequences for d4fqqe2:

Sequence, based on SEQRES records:

>d4fqqe2 b.1.1.2 (E:109-209) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvap

Sequence, based on observed residues (ATOM records):

>d4fqqe2 b.1.1.2 (E:109-209) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadssvetttpskqsnnky
aassylsltpeqwkshrsyscqvthegstvektvap

Timeline for d4fqqe2:

• d4fqqe2 first appeared in SCOPe 2.03
  
• d4fqqe2 appears in SCOPe 2.07