Lineage for d4fqqc1 (4fqq C:3-108)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2742901Domain d4fqqc1: 4fqq C:3-108 [221458]
    Other proteins in same PDB: d4fqqa2, d4fqqb1, d4fqqb2, d4fqqc2, d4fqqd1, d4fqqd2, d4fqqe2, d4fqqf1, d4fqqf2, d4fqqh1, d4fqqh2, d4fqql2
    automated match to d1adql1
    complexed with na

Details for d4fqqc1

PDB Entry: 4fqq (more details), 2.42 Å

PDB Description: crystal structure of germline antibody pgt121-gl fab
PDB Compounds: (C:) Fab light chain

SCOPe Domain Sequences for d4fqqc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fqqc1 b.1.1.1 (C:3-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yvltqppsvsvapgqtaritcggnnigsksvhwyqqkpgqapvlvvyddsdrpsgiperf
sgsnsgntatltisrveagdeadyycqvwdsssdhpwvfgggtkltvlg

SCOPe Domain Coordinates for d4fqqc1:

Click to download the PDB-style file with coordinates for d4fqqc1.
(The format of our PDB-style files is described here.)

Timeline for d4fqqc1: