Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (15 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
Domain d4fqqa2: 4fqq A:109-210 [221457] Other proteins in same PDB: d4fqqa1, d4fqqb1, d4fqqb2, d4fqqc1, d4fqqd1, d4fqqd2, d4fqqe1, d4fqqf1, d4fqqf2, d4fqqh1, d4fqqh2, d4fqql1 automated match to d1adql2 complexed with na |
PDB Entry: 4fqq (more details), 2.42 Å
SCOPe Domain Sequences for d4fqqa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fqqa2 b.1.1.2 (A:109-210) automated matches {Human (Homo sapiens) [TaxId: 9606]} qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq snnkyaassylsltpeqwkshrsyscqvthegstvektvapt
Timeline for d4fqqa2: