Lineage for d4fq8a2 (4fq8 A:105-263)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1830524Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1830525Protein automated matches [190069] (203 species)
    not a true protein
  7. 1831303Species Helicobacter pylori [TaxId:85962] [226244] (12 PDB entries)
  8. 1831310Domain d4fq8a2: 4fq8 A:105-263 [221443]
    Other proteins in same PDB: d4fq8a1, d4fq8b1
    automated match to d1p77a1
    complexed with skm; mutant

Details for d4fq8a2

PDB Entry: 4fq8 (more details), 2.07 Å

PDB Description: crystal structure of shikimate dehydrogenase (aroe) y210a mutant from helicobacter pylori in complex with shikimate
PDB Compounds: (A:) Shikimate dehydrogenase

SCOPe Domain Sequences for d4fq8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fq8a2 c.2.1.0 (A:105-263) automated matches {Helicobacter pylori [TaxId: 85962]}
dalgfylslkqknyqnalilgaggsakalacelkkqglqvsvlnrssrgldffqrlgcdc
fmeppksafdliinatsaslhnelplnkevlkgyfkegklaydlaagfltpflslakelk
tpfqdgkdmliyqaalsfekfsasqipyskafevmrsvf

SCOPe Domain Coordinates for d4fq8a2:

Click to download the PDB-style file with coordinates for d4fq8a2.
(The format of our PDB-style files is described here.)

Timeline for d4fq8a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4fq8a1