SCOPe 2.07: Domain d4fp8o2: 4fp8 O:107-213

Lineage for d4fp8o2 (4fp8 O:107-213)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)

8. Domain d4fp8o2: 4fp8 O:107-213 [221432]
   Other proteins in same PDB: d4fp8a_, d4fp8b_, d4fp8c_, d4fp8d_, d4fp8l1, d4fp8m1, d4fp8n1, d4fp8o1
   automated match to d1dn0a2
   complexed with nag, zn

Details for d4fp8o2

PDB Entry: 4fp8, 2.95 Å

PDB Description: crystal structure of broadly neutralizing antibody c05 bound to h3 influenza hemagglutinin, ha1 subunit

PDB Compounds: (O:) Antibody C05, Light Chain

SCOPe Domain Sequences for d4fp8o2:

Sequence; same for both SEQRES and ATOM records:

>d4fp8o2 b.1.1.2 (O:107-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d4fp8o2:

• d4fp8o2 first appeared in SCOPe 2.03
  
• d4fp8o2 appears in SCOPe 2.06
  
• d4fp8o2 appears in the current release, SCOPe 2.08